DPCstruct | MC18039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822AW77 | 1-128 | MVSQWTICGDQTKSMFADREYCRQLDPYGTPIGVYEQPDYIYQCAGYWREDSRSYLITYDRDDPYINFKCWVYERIDLFKIYLSRSA… |
| A0A182SKE5 | 323-434 | SDFSVCDGDQKEMTIDADYCLSVDYLGRPIDIYSDPDYRMKCIGYWQENLKSYLITYDDLDPLSKYRCWVYQRADLNRVLMSQAVGA… |
| A0A5N5SLM2 | 104-250 | None |
| A0A177BBN6 | 727-858 | None |
| A0A820ZLX4 | 896-1014 | None |
| A0A1J1J0T9 | 446-571 | None |
| A0A0R3SQX1 | 486-621 | None |
| A0A1S4ED92 | 227-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.