DPCstruct | MC18037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 296 ± 67 aa |
| Standard deviation of domain lengths | 67.30 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.14 |
| Pfam Score | 96.56 |
| Assigned Pfam label(s) | CL0129- PF11708- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6BPJ4 | 63-325 | LSHQSVQQHQKSALDEPVLRGVTSRVAVRYRKNACENCGASTHDVKSCVERPRKKGAKYTNANICPDEYIVENKATGYEAVRDRWSG… |
| A0A818IFH8 | 638-1023 | HIQLRSVSDQIFLESYARGHADKIATRYRPGACENCGAMTHKRKDCVERPRRLGARFTGTDFAPDEYIQPDINLSWDGKRDRWNGVD… |
| A0A6A6L2C3 | 37-216 | None |
| A0A817U1G0 | 64-470 | None |
| A0A367JD79 | 59-419 | None |
| H2YSG7 | 3-251 | None |
| A0A822XSV7 | 2-205 | None |
| A0A4V3WQS1 | 40-278 | None |
| A0A835GWH6 | 71-270 | None |
| A0A1A9X781 | 6-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.