DPCstruct | MC18031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 80.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0200 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151T398 | 50-116 | ELDLLKEDANVYKLIGPVLVKQDLAEANANVRKRIEYISAELKRLDATVQDLEEKQNSKKDTVCNFS |
| A0A6P8D8Q3 | 73-144 | IQLGENELVQKELDLLNEGANVYKLIGPVLVKQDLAEANANVRKRIEYMTGELKRLDAILQDLEEKQNSKKE |
| A0A804UAA7 | 99-171 | None |
| A0A804Q9A8 | 232-300 | None |
| A0A5N5FBF7 | 1-72 | None |
| A0A4Y1RAB3 | 13-75 | None |
| A0A3L6FK59 | 85-146 | None |
| A0A0D3F316 | 93-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.