DPCstruct | MC18028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 4.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9P877 | 33-116 | EEDLEAMIAEFQNLDAKKTTVVETICPPPSARLSASISAHPEKDELILFGGEFFNGRKTYLYNDLFFYNIKKNNWVKSEIPNPP |
| A0A7J6X2D3 | 1-85 | MLGILSIEDDIDAILMSIQKEEVKNKEVIVEENATGPSPRSNCSMTINPLKVTELIFYGGEFYNGNKTFVFGDLYRYDVHKQDWI |
| A0A7C8JTM5 | 34-123 | None |
| B4HG38 | 41-113 | None |
| A0A455BGB5 | 33-114 | None |
| A0A397AIW7 | 40-115 | None |
| S9YJ30 | 33-114 | None |
| A0A0D2U3E9 | 36-116 | None |
| A0A5E4QSF0 | 35-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.