DPCstruct | MC18025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6WVZ2 | 31-122 | DLFLRRLKTFVKARHLERLQLPLMVNDKENEEKLRIAFTITVDAKHGTTTGVSAQDRTATILVLASRDLKAEDFIRPGHIVPLRYRV… |
| A0A080KN16 | 15-91 | CMPQSFCDKLELPMMVTNNTSKNHTAFTITIEAAKGVTTGVSAADRVTTVKAAVADNAKPSDLNHPGHVFPLVAKEG |
| G4MAL5 | 26-116 | None |
| A0A366ZVN2 | 3-80 | None |
| A0A845JC96 | 48-136 | None |
| A0A542QX98 | 35-131 | None |
| A0A7C7XCG8 | 60-134 | None |
| A0A2T6ZSL8 | 72-143 | None |
| A0A098DEC9 | 145-236 | None |
| A0A177WMA1 | 357-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.