DPCstruct | MC18023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 148 ± 30 aa |
| Standard deviation of domain lengths | 30.42 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 68.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6WRM1 | 5-160 | GKALALEDYIEFLENPHGHDLTNSHLNQIISMHGFKKMHHSQKVELVDALNTMDLLYPNRSTLKQNISSSDAANLLSTEEVIKDLDL… |
| A0A0D3DYR8 | 1-119 | MKGGGEKKMTLEEYVDYFSSGKSIYFTCSYLNQILHLHGFRKLHHSTKKTVGEAVDAVELLDLSRSILNQTTLSSSSASLTLDQVIT… |
| A0A2J6JJQ0 | 11-142 | None |
| A0A2U1MJ68 | 14-152 | None |
| A0A4Y1R5I3 | 5-119 | None |
| A0A5B7C292 | 14-164 | None |
| A0A6G1DRH7 | 1-236 | None |
| A0A0D2RMX2 | 2-135 | None |
| A0A061EPF1 | 88-261 | None |
| A0A2Z7BKK4 | 13-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.