DPCstruct | MC18022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 6.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 78.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03849 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DGT1 | 121-208 | AYSLSTLTEVQRVAIMDLMELGLVKLQQGRKDSWFIPTKLATNLSSSLSDSAASKEGIVVVETNFRLYAYSASKLHCEILRLFSRVEY |
| A0A2K2DM19 | 140-222 | AYSFNTLTDVQRIAIRDLAELGLVKVQQGRKDSWFIPTKLATNLSSSLSDSSASKEGIVVVETNFRLYAYSASRLHCEILRLF |
| A0A540M6D8 | 1-95 | None |
| A0A453DGV0 | 160-242 | None |
| A0A7J6HFH0 | 325-424 | None |
| A0A6A3C2F7 | 240-322 | None |
| A0A453DGR1 | 41-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.