DPCstruct | MC18021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02469 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9IU57 | 102-180 | KHTLETSLSHGSKVDTLLHGHPLVVTTIPGKTTNASINEVKIVEWDIYNDGHVILHGVEDFFDPAFQILKYPWYDDYDG |
| A0A7J6WQP9 | 45-103 | HGSKIDTFLPGHPLVVTTLHNSTEASINGVEITQWNIYNDGNVLVHGVADFFYPAYQTI |
| A0A7J6VKL5 | 18-98 | None |
| A0A498I9J9 | 1-72 | None |
| A0A835LF33 | 59-143 | None |
| A0A5E4ECW8 | 69-137 | None |
| A0A4S4DBT0 | 64-131 | None |
| A0A4S4D0G2 | 67-126 | None |
| A0A540K805 | 7-83 | None |
| A0A822YEH8 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.