DPCstruct | MC18020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1019 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 27.36 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.12 |
| Pfam Score | 96.93 |
| Assigned Pfam label(s) | CL0125- CL0129- CL0405- CL0194- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6WPH2 | 29-165 | KKQVPKDFPSLKLMKNTAKVKNPLQLVVQMQRSHFKYRTLLVSAPFGRKSGLVKMAKSAKETNKSYMITIKDPNGKPWKLQLNYKPS… |
| R6EXI9 | 1-128 | MRELTDLESLNVDFLNSHGIEYTTVCLTANILDHGIFDASKPIKTYLKDMGIHDFDSQKSGEKVLIPTHIISFQEDVLCNSSLYRAG… |
| A0A834SSL8 | 2-126 | None |
| A0A164XZJ1 | 14-126 | None |
| A0A164YAX1 | 102-215 | None |
| A0A164YGW8 | 99-220 | None |
| A0A164ZXR6 | 157-260 | None |
| A0A165A420 | 148-243 | None |
| A0A166DLL9 | 15-159 | None |
| A0A444X2F5 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.