DPCstruct | MC1802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 18.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2K393 | 7-146 | PDILIRALSSPDWPSKPIWGSKLRHLHPMFDRFNIELLQTLEQLIHNTLANFAQRPDNRDHLKLTIGSQFGESVLPVLDVEQAVVFG… |
| L0DHX3 | 1-94 | MIFLFAPPFHTVRERASSNPYWMDPLAAPSEIDFDLALDIGDFGLGSDAPILLDYREDPEMPRVIRLRWPPDGCANHWVMMAPDFEM… |
| A0A4Q8C6W8 | 9-135 | None |
| A0A1I3DIZ6 | 65-207 | None |
| A0A1R1IHF0 | 138-276 | None |
| A0A1G9LQW6 | 14-170 | None |
| A0A3E0ND90 | 5-145 | None |
| A0A7Y4Y6U7 | 24-173 | None |
| A0A2G7D737 | 1-105 | None |
| A0A5Q4SJS0 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.