DPCstruct | MC18015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9SF04 | 106-213 | YAVVDLNSLPAAVEQNGADPEAIAVALFGNTEPTEGNFEEEIDSQIVDDQAVVTITQLGLADDSVRGVRYMLKFDQMDDQTWQLVWV… |
| A0A7Y8Y4A8 | 27-117 | IATPEALIVLYYDYPTREGTPNLQLSKKEIGPQHFEITLIHDNLDDDSVKAIKIDMTAKRIGNTWQVQKILKSWKCYDGRDHTDWSS… |
| A0A410G1G2 | 170-286 | None |
| A0A3S4FX77 | 5-83 | None |
| Q28W65 | 2-120 | None |
| A0A3A4VG50 | 33-139 | None |
| A0A3R8MR42 | 303-394 | None |
| A0A3E0PG24 | 180-268 | None |
| R4YV45 | 28-159 | None |
| A0A1Z4NPV8 | 61-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.