DPCstruct | MC18012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07852 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428GJN7 | 4-146 | YKQRMIDEYNQLKERCMRIEIFLKAYKERQVPDFELSCPLELLQSQYHAMRSYLKILETRAKFERIDLIEKEKIYTVEIPVGDGFFQ… |
| A0A6M0MBW3 | 33-189 | YGVRLKVAEKEYIEKEIANLTPQLQQQTLPVVPECVAVQIERVKNSNGNFATLGLFDRNHESKPDYTKWIHENVFDFMRACTIGYTV… |
| A0A1X0V8X4 | 24-182 | None |
| A0A0R1UCZ6 | 22-172 | None |
| A0A1K1KNZ9 | 127-274 | None |
| A0A654XNH5 | 7-139 | None |
| S4FTI7 | 22-177 | None |
| A0A116N432 | 1-129 | None |
| A0A4V0AER9 | 106-239 | None |
| A0A386PRW9 | 3-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.