DPCstruct | MC18010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 499 ± 93 aa |
| Standard deviation of domain lengths | 92.76 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7RJK0 | 3-514 | FSSENSELQPCLQVYQVACRFMLVWKKDRDKERFEKLCRYLVSSLESSSIKLSYVGVALNKEYAIAWIAHVKDVLWKCCCYLDELRP… |
| I7GMF8 | 1-490 | MFTLSQTSRAWFIDRARQAREERLVQKERERAAVVIQAHVRSFLCRSRLQRDIRREIDDFFKADDPGSTKRSALCVFKIARKLLFVF… |
| A0A5S6Q0F3 | 29-590 | None |
| A0A821IQ14 | 1-439 | None |
| A0A0R3T3Z9 | 12-472 | None |
| A0A2R9B8S1 | 3-373 | None |
| A0A7J7P8H9 | 19-612 | None |
| A8P7F1 | 8-349 | None |
| A0A7R9FQE5 | 1-497 | None |
| A0A7J7GMV4 | 17-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.