DPCstruct | MC1801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3ABI9 | 4-108 | MPDPTWQASLDFLRDLHGISAAQVNAITLAQARDRWQHAVIARTSMHDLLFTLPGDGYPFTSSVRVQSANGRYVLLRWENDRLVEEK… |
| A0A2G2JW44 | 50-166 | LPDRNKESWIEIIAFYEALLDSDYSDVAPLLLDLVSRFGATPRAERFRAGQSLWHLMISTAAQRGLKDHEPFVAVTINDDFQFQIEY… |
| A0A3L7N7D0 | 157-293 | None |
| A0A1Z4HEH8 | 8-146 | None |
| A0A366HVF8 | 1-124 | None |
| A0A4R1A232 | 3-142 | None |
| B0BGX6 | 1-136 | None |
| A0A222F644 | 5-142 | None |
| A0A177PUD2 | 4-118 | None |
| A0A2D6SWE8 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.