DPCstruct | MC18009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 29.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.31 |
| Pfam Score | 89.52 |
| Assigned Pfam label(s) | PF02177- PF12924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182VRV7 | 1-121 | MVYPGRDITNIVESSHYQKIGGWCRQGALNAAKCKGAQRWIKPFRCLEGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAAC… |
| I7G8J3 | 29-189 | LAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPY… |
| A0A7R9NVS0 | 6-112 | None |
| H9GNC2 | 23-202 | None |
| A0A183M4U8 | 20-181 | None |
| A0A7J8AE88 | 31-193 | None |
| A0A1I7XY11 | 24-198 | None |
| A0A1I7Y9M6 | 28-230 | None |
| A0A0S7JU34 | 22-205 | None |
| A0A4U5MH01 | 15-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.