DPCstruct | MC18008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 235 ± 14 aa |
| Standard deviation of domain lengths | 14.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O68653 | 6-240 | KEELIKLAYSIRPRENEYKTVLTNLDEYNKLTTNNNENKYLQLKKLNESIDVFMNKYKNSSRNRALSNLKKDILKEVILIKNSNTSP… |
| A0A3G2FFV3 | 35-246 | LILLDILKTVYVEIISKSSYNSKEANINSIAETFSHAAIAYESGIASNILKSLIFIDELLISIENNFHDIPMYILKKKLLALYQLAF… |
| A0A6L2ZRZ3 | 7-239 | None |
| J2WWR7 | 7-244 | None |
| Q9EXR0 | 9-230 | None |
| A0A2U8I5V6 | 3-250 | None |
| E0WUB6 | 3-225 | None |
| A0A828U171 | 184-412 | None |
| A0A7U6JX76 | 169-418 | None |
| A0A2R7TFL7 | 5-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.