DPCstruct | MC18007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 160 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6XRE4 | 203-352 | MTTKTPAVRIAQWEAKCNHKLQCLYPGSHPHLGKSGLSRMFSGLSLKENKEAKKYSAYVENHHGFFVPRNILHCEQQIHQILKLKFG… |
| A0A1G4JI55 | 1-146 | MTRKPTVLARLLEWENSCKHPVTGLDPTKVQELCRSVRIEHRSSKSLVRLFQKLSISKHKSQAPMEHHLAQLSGFRDGGFYVANDRS… |
| A0A0C7N3W9 | 1-176 | None |
| A0A376B3D6 | 144-312 | None |
| A0A1G4KKX1 | 103-279 | None |
| Q6FL13 | 1-146 | None |
| A3LST4 | 89-229 | None |
| A7TH20 | 41-218 | None |
| A0A1A0HE81 | 119-277 | None |
| G0V9P5 | 35-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.