DPCstruct | MC18006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08636 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9XIJ4 | 2-84 | SFVEALWDSVFQPGVPPVLVAATHVSFTLLLALLLALLWTTRNLHFMALSVIAAFLWATVSWFVRELARAEAEGAPAPAVDGA |
| A0A1G4JAQ4 | 1-108 | MGNFFEELWNSIFTPGTSPQLIVATHVSFVLLSCCLGWLIYCTRNLHFVALLTISTLLWITVTWFVNELHYAKLRDNEELAKTQGEK… |
| A0A3N4HG04 | 15-129 | None |
| A0A7D9H2F6 | 2-117 | None |
| M1W319 | 1-130 | None |
| A0A3N4LUI6 | 1-90 | None |
| A0A1V2L3N2 | 1-110 | None |
| A0A6A6ISK4 | 1-142 | None |
| A0A0X8HUR9 | 1-91 | None |
| A0A061B2P0 | 40-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.