DPCstruct | MC18004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0203- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W1SLI7 | 5-76 | MRSPLGELPNPPADLDGDGLFEDINHDGNVTVSDVQALFANRDGSVAQDNAGRFDFTQDGQLNIVDIQHLFV |
| A0A7J4IP23 | 3-66 | MPPLDLDGDGRYEDVIGNGRKDFADVMLFFNQMAWIATNEPLAAFDCNDNDRIDFADVVWLFTH |
| A0A6A9T090 | 137-209 | None |
| A0A847V785 | 277-357 | None |
| A0A1V5IK41 | 125-208 | None |
| A0A847PVE8 | 756-849 | None |
| A0A6A9T798 | 364-457 | None |
| A0A6A9T6A4 | 907-1001 | None |
| A0A6A9SZA0 | 180-269 | None |
| A0A847V8L9 | 17-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.