DPCstruct | MC18003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8KTQ3 | 216-345 | LPIERVLHHHAHAAACLAEHGWPLEGGDVIALVLDGIGMGEGGALWGGECLRVNYRQCEHLAGLPAVALPGGDLAARQPWRNLLAHC… |
| A0A7J4IJ74 | 1-148 | LHPQFLSTRYARELADELGIPAVPVQHHVAHIASVTREPCVGIAIDGVGYGADGTVWGGEIFAGAVPSFNRAGHLEVVPMPGGDLAT… |
| A0A3M1JH83 | 258-406 | None |
| Q1NML4 | 389-556 | None |
| A0A1V5U8G1 | 254-417 | None |
| A0A351I6C7 | 75-207 | None |
| A0A263DG82 | 68-222 | None |
| A0A349MFF0 | 269-419 | None |
| A0A1V6FU09 | 503-653 | None |
| A0A842JAM1 | 157-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.