DPCstruct | MC1800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 101 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R6PS21 | 2-96 | SNYFVYCPDCGMEEYDTIEKRDAAAHDCIQHHLNDGWDEAVDQVVAGVITSRATQTDLKKRPPDSEIDENGEDEHGSDWSGDFEFIC… |
| A0A2G2JVR1 | 2-84 | DKFFCYCPDAGFDTFETEKEAKESAETSIDWYRDNADEGWDDAVNQVCWGEIKQHASICNVRPSTEDDCVSADCDTICDYQLK |
| A0A849JKR9 | 41-142 | None |
| A0A7X5FZ82 | 3-105 | None |
| A0A381E7M8 | 26-153 | None |
| A0A2V3Q0S0 | 52-143 | None |
| A0A5E5A6M1 | 126-240 | None |
| A0A7Y4DAM3 | 4-105 | None |
| A0A368AM76 | 6-116 | None |
| A0A2G8EJA7 | 44-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.