DPCstruct | MC180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0LMQ5 | 1-89 | MKLCSPTLVYLMFSISKILIDIYNKVYEEAFMKMLVTILISILLNILCERGLESVAWMIVFIPFLLMSIIVGMLVYYFGLNTQTGEI… |
| A0A6C0BVH6 | 3-112 | LESICTPALIYLVFSIIQIILDTGKGLYNTAFLKIFVTFLFTIFLNYLCDSGLGVISWIIVFIPFILMSIIISILLLMLGLDPTTGK… |
| A0A6C0DIP9 | 4-102 | None |
| A0A6C0D450 | 3-90 | None |
| A0A6C0LGD6 | 3-104 | None |
| A0A6C0JK36 | 1-86 | None |
| A0A6C0IDD6 | 4-96 | None |
| A0A6C0C470 | 3-113 | None |
| A0A6C0JBU6 | 5-112 | None |
| A0A6C0EVU8 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.