DPCstruct | MC18
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 73 ± 3 aa |
| Standard deviation of domain lengths | 3.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 95.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662VGJ3 | 4-77 | AKYECRLCGRIVCEEDYDHEKKLCKVCSSALCEICGKNLSIGYCMVCGRSGCEDCLIQVSTVSYVCKECIRKGR |
| A0A7C4HEM3 | 10-84 | KQSVFKCSICGRNVCEKDFDLDKKICRICCETLCKICNKYLSIDKCSICGRNGCEKCLIKITPFQYICIDCYRKM |
| A0A662I5A2 | 12-83 | None |
| A0A7L9FIU5 | 1-66 | None |
| A0A7J2KEY2 | 2-73 | None |
| A0A432R893 | 29-100 | None |
| A0A7C5SX81 | 12-83 | None |
| A0A6B2C8E0 | 15-91 | None |
| A0A833EHE4 | 2-79 | None |
| A0A4D8S6S9 | 13-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.