DPCstruct | MC17995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5GKV1 | 5-112 | VILMKCPETGGIYGVRTEERHGDWYRTWAFKVNERTAAREGFDKTVIRGNLIPDDEYNGCPYCKAVYFVQCSRCGKLSCWNGEERMT… |
| A0A3D4ZRJ9 | 102-227 | GEIDMYCLCSETGQPFVVYWYEAQPGIYAISRIDKVVAERAGGGGGVSAIAGTFSLDGFEGCPHCGCRGLSVCEACGTTNCEGATQT… |
| A0A350AVS8 | 4-107 | None |
| A0A0C2ZTZ0 | 209-343 | None |
| A0A350AVS6 | 2-114 | None |
| A0A7C5MMH9 | 143-271 | None |
| A0A380MPV6 | 42-191 | None |
| A0A1V4CHW4 | 35-182 | None |
| N8UNP5 | 63-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.