DPCstruct | MC17991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 126 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.82 |
| Pfam Score | 50.92 |
| Assigned Pfam label(s) | CL0127- PF14081- PF14080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6DFU7 | 55-161 | DRFIRFGVNVRFFNIEGTEDMLIDTVGMSTLFLPDLQYHFHDMDPNWVVNRAYNVASYILEHDNPIQDGETIDGVADGQMCREIQWK… |
| A0A1I2IPM5 | 10-156 | FFDEQSEIIEKFGWAVVHVVPTEDDPPDTVPFAYTVGLTGYGFPELTIAGLPPETGHVLLNEVAGRVCDEGLLLRHGHRLRGLLDGQ… |
| A0A3D9QT54 | 108-253 | None |
| A0A2W6W3D3 | 60-202 | None |
| A0A3M2C6K3 | 55-193 | None |
| B8IQL4 | 103-251 | None |
| A0A5C7YIK0 | 17-175 | None |
| A0A2G4GVV4 | 64-188 | None |
| A0A2L1U572 | 34-151 | None |
| A0A1D3K8J4 | 75-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.