DPCstruct | MC17989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 5.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A066YMM1 | 34-147 | SIQSTLARAAADLHQGRVDLARRRLHGLLSGHPTDLAVRRALAEAYRHDPQPSEVGRWNYLDDSLTTTELAAYERRFRDPARRLANL… |
| A0A1I2DC91 | 1-104 | MAKSDVLAKVDADLDRGHTHLAAQRLNSLIAADPYDLGLRARLAAVHRRTGNLAEAGRWGYLTEDVTPAELAAFDKAYYRSAPDQLR… |
| A0A7W9Q236 | 1-103 | None |
| A0A1H2MHS7 | 3-116 | None |
| A0A235F8K9 | 3-109 | None |
| A0A3A3YMK3 | 2-103 | None |
| A0A1I7GBM5 | 42-157 | None |
| D6A3Y9 | 100-200 | None |
| A0A4R4KSW1 | 18-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.