DPCstruct | MC17988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150QVP2 | 107-188 | SGGADYHQMRILDVDGDGKDEIADGGYVIDDNGKVLYNLAPQGVVHGDRFHITDLDPARPGLEGWGIQQDNPNGLETYYYDA |
| A0A2P5HDX9 | 163-229 | APDGHNTRIIDVDGDGRDEVSEIGFTLNSNGTVRYFMGPKGITHGDRFHIAKMDPSRAGLQGYGVQQ |
| A0A0P0L9A9 | 27-121 | None |
| A2DPK9 | 313-399 | None |
| A0A820UM11 | 30-117 | None |
| B8I5Y4 | 363-437 | None |
| A0A7C6GCN8 | 633-719 | None |
| A0A2S8R836 | 919-1003 | None |
| A0A5P2G2G2 | 592-680 | None |
| A0A7C4X8F9 | 63-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.