DPCstruct | MC17984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 241 ± 42 aa |
| Standard deviation of domain lengths | 42.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16162 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519RSD2 | 8-248 | VIEFGVGFENGNQPVILNKISINDSVREALDEMKENFEAQYLAIPDVVEVFELSEKYAPTEKLTYPLVQAELPELFDLYANTGAIPM… |
| A0A4U6QAL2 | 106-348 | ASLLMVTDHRTSRPRVFAAPVDLAFAEQLVELATEVSTDAAEAEWRPAAPGFTPAAGQWLWTATAHTPLAGLDEEICRPTHAPYQRS… |
| A0A2D3JJT0 | 4-287 | None |
| A0A376TF69 | 14-232 | None |
| K8ZL57 | 3-332 | None |
| A0A2P1MMU9 | 50-306 | None |
| A0A2U1S6U7 | 2-274 | None |
| A0A1I2VXW3 | 4-271 | None |
| A0A553UWZ7 | 1-186 | None |
| A0A7X8DUK0 | 1-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.