DPCstruct | MC17983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7LG21 | 343-421 | LRDSVYNVETLVSPLTCVDARQYGTLLMVDLKDEYFVQDIEKLRDDILNVGLGLVVFAEWYNVDTMVKMRFYDDNTKRW |
| A0A182SPU7 | 86-164 | LRNAGYYVEVLGAPYTCFNASHYGTLLVVDPEEEFFPAEIAKLREDVLDRQLSVIVFADWYNTSVMRRIKFYDENTRQW |
| A0A7M5XJI2 | 293-371 | None |
| A0A158QV07 | 209-294 | None |
| T1GUD9 | 77-155 | None |
| A0A0M0K9U8 | 299-376 | None |
| A0A7J7KZE6 | 217-295 | None |
| R1DDY7 | 644-721 | None |
| A0A0D2MTR6 | 667-764 | None |
| A0A0L7KZF6 | 62-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.