DPCstruct | MC17981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1VK63 | 341-477 | HNTFRLWGYYGYEKGFLGYASNKYKQESKQAGHATLGDDYIIQKISDGTFSTLEDWKKAYFNEVVTSAKNGLQAIEVDGTTYSTYDD… |
| A0A1S9ZBA6 | 1-138 | MAALGYYEGFVPYVSNQFKEEAEAEGVPLSDKYIFDKILGKTYAEFKKEQINERVEKLGKLTPITINYNGKEEVIDSKEKLQELMNK… |
| A0A139RGU6 | 292-419 | None |
| A0A0T7K3A1 | 156-290 | None |
| A0A1S8KNB2 | 907-1040 | None |
| Q59986 | 1689-1854 | None |
| A0A3P1VGE7 | 938-1083 | None |
| A0A139RI03 | 125-253 | None |
| A0A139QD20 | 1-128 | None |
| A0A1M4NJ51 | 1137-1271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.