DPCstruct | MC1798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 19.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5JWK0 | 3-140 | PAVALGEFAPADPGAEAATGKLTIEDMAIRGANGAAFVTERAAIVRGNDQYNAEARYADSMLIVPEQTVELRRVVERTLPEKSNADP… |
| A0A4Z1RC51 | 52-206 | HDPQLRPGSRAAPPMLHPVALGPFETGNPTAESITGSITIEGSRIVGENGAEFVTERIAILRGGDEFLPGQRYADAMMIGTEHPVEL… |
| A0A443LWW6 | 8-187 | None |
| A0A1J5QHA9 | 200-334 | None |
| C5B5F1 | 15-144 | None |
| A0A7Y8MEN6 | 4-144 | None |
| A0A345R7L1 | 2-114 | None |
| A0A0Q6ENR9 | 20-145 | None |
| A0A318QCX5 | 1-146 | None |
| A0A7C8HJY8 | 28-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.