DPCstruct | MC17977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 17.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8Q5V7 | 1-119 | MNEPHRGYVNLYSFDRWNYNTDLHIGHYPSALQSLALGDGHVQNIPFYTKTWPLPSRLSHYTRVDPCGRLAWLQRNDSIAFPNTRQQ… |
| A0A829D933 | 238-342 | LNEPSPGWIGKKNLGEFDGFGFGKVVKSSPFQEMYLSEGRAVSAAQAYMLGFWSLPFGKVRLNPEGVPLWERGHQCIWRNHGVWDYD… |
| T5A6M3 | 106-249 | None |
| K3WLM0 | 102-209 | None |
| A0A836DBI0 | 233-359 | None |
| A0A0B7NAD8 | 258-364 | None |
| A0A2H5SIT5 | 347-472 | None |
| J4G5E8 | 691-824 | None |
| A0A535QW46 | 7-109 | None |
| A0A4Z0A6T1 | 102-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.