DPCstruct | MC17976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 345 ± 57 aa |
| Standard deviation of domain lengths | 56.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | PF01422- PF01424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4M236 | 63-390 | HFGSCPKCTSLTEKTCYCGKNKVKIPCYIESASCGQICGKPMPCGVHVCKRVCHDGPCTENGQCPYECGKKKPYCTHNCNSKCHGNT… |
| A8Q2Z3 | 1-331 | MSAVPCSRRNVRCGEPCRALLACGQHICPGACHAEGECPPCNQVCGRPRPVCGHPCERPCHAPEPCSADEPCKAVLARRCACGHREK… |
| A0A1C7N5K6 | 217-633 | None |
| A0A1I8FBE0 | 222-552 | None |
| A0A815P047 | 1-252 | None |
| A0A194VQM8 | 57-449 | None |
| A0A6I9YH40 | 326-642 | None |
| B0EPV2 | 433-756 | None |
| A0A0M8MYU6 | 520-943 | None |
| A0A7J6L108 | 794-1097 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.