DPCstruct | MC17973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 141 ± 26 aa |
| Standard deviation of domain lengths | 26.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.94 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 39.23 |
| Pfam Score | 95.48 |
| Assigned Pfam label(s) | CL0352- PF21526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B1BUY6 | 20-128 | LIGDGANGYTNAQGVGTAGGAGGWLYGDGGTGGTSTRAGVPGGAGGPAGLIGDGGTGGKSVYGGMPGGTGGRGGLLIGDGGTGGASG… |
| A0A447GCC5 | 12-137 | LTGRSLIGNGANGSPGTGADGTPGGWLLGNGGAGGSGAAGMPGGAGGAAGLLGSGGAGGAGGAGGQLLGNGGGGGEGGAGDGGGGPG… |
| A0A100ICV4 | 102-278 | None |
| A0A1X2BEP6 | 89-238 | None |
| A0A100ID47 | 1-117 | None |
| A0A2Z5TL81 | 2-153 | None |
| A0A2Z5TMI9 | 3-146 | None |
| A0A7I9WIC2 | 162-360 | None |
| A0A4Z0MXY9 | 382-516 | None |
| A0A1Q6KKD4 | 13-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.