DPCstruct | MC17970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6U9T8 | 1-121 | MPLKLQIPKEISKKLTTLYNRAEHLTAYLNQTEFTITIKFKRVSQKELETNFTEIRDWIEALEKSPFEVEFQEIAYRSLGRQRMPYL… |
| A0A7G9TRU4 | 2-100 | RFPEEVRKRLQQAWARNTAAWIADPSGAAVSVPLHPPTGAEALADPTSAHTWIDAWRSAGPLAEFVAWEERRWAHLGTQLVPVRWQA… |
| A0A1Q8YE38 | 1-133 | None |
| W0VBE8 | 1-123 | None |
| A0A1T2L597 | 1-136 | None |
| A0A4Q9R6V8 | 1-115 | None |
| A0A1F4JXV8 | 1-123 | None |
| A0A538NBG8 | 8-126 | None |
| A0A3S0AY02 | 1-128 | None |
| D6EAQ6 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.