DPCstruct | MC1797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A161J847 | 119-231 | ADTPLAGEAGLDDAVRKGYLREATPADARNWQMAAAAAQGAGDVPPVYGGTKPRPVRMYHAYVVLKPFTLPAGLYGAHSATFFVPKG… |
| A0A419DHP9 | 122-234 | ERERQWDKDHKERADAFKSNILPHLRPATVNDYRKWIVGFISNGGTVTHHYDYDMPDDVYIALDSFEITPLYGASSINVIVPAGIEV… |
| A0A358C542 | 808-917 | None |
| A0A1G2R323 | 16-132 | None |
| A0A4S1WHT2 | 234-334 | None |
| A0A844SH25 | 167-263 | None |
| A0A1Y3D010 | 205-328 | None |
| A0A2A5GWN6 | 219-331 | None |
| A0A2A2AKY3 | 321-416 | None |
| A0A7T5RKM4 | 80-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.