DPCstruct | MC17966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533UCV7 | 2-57 | LKLKCKDAGFDCKFVAKGKTEDEIMQKAAEHAMKDHGMKPEDMTPEMKEKIRSHIH |
| D6GVG5 | 1-58 | MAYKFSCRDTGLDCDFKAEAETMDELMPKIAEHGKQAHDMAEISDETMQKVKAAITEE |
| A0A353ZYK5 | 4-67 | None |
| A0A7V8SWP5 | 1-58 | None |
| A0A523UHM1 | 1-79 | None |
| A0A1F9BU07 | 1-56 | None |
| A0A3N5UV56 | 26-85 | None |
| A0A3N9UW49 | 6-72 | None |
| A0A3N5X799 | 14-72 | None |
| A0A3C1G3F1 | 20-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.