DPCstruct | MC17965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8S335 | 1-56 | MALAVIDRAIQAFGGAGVSDDFPLARLWANARTLRLADGPDEVHLDQIARLEIKPY |
| A0A7S3Z4U7 | 144-195 | ALKVVDRAIQSYGGMGVCQDTVLAYMWACCRTLRLADGPDEVHMRTIAKLEM |
| A0A1B5E4C1 | 1-56 | None |
| A0A812TVG3 | 108-171 | None |
| A0A060SIK1 | 1142-1219 | None |
| A0A1X7U6X2 | 8-63 | None |
| A0A2N5SCD4 | 52-123 | None |
| A0A7D9J3B5 | 229-287 | None |
| A0A3L6NUJ8 | 85-146 | None |
| A0A443I8K6 | 1174-1247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.