DPCstruct | MC17962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I0SME2 | 40-170 | EPFQIPTSKDIENLIGTDLYDVWNSLCQRIEKSYEMELLWNRGGKAWTYEYKYRKGGKTLCALYAKEKTLGFMVILGKDERAKFEIQ… |
| A0A7V6YR62 | 416-551 | IMDKVPTSEDLIALIGKPLFEVWTALCGMIEQKYDMEHLWNNGGKAWEYEYKYRRCGKTLCALYAKENCFGFMVILGKHERTKFETD… |
| A0A1M4M452 | 143-278 | None |
| A0A1F3BDU8 | 2-124 | None |
| A0A7X8MKW7 | 10-142 | None |
| A0A174ET83 | 11-137 | None |
| A0A524QS39 | 11-135 | None |
| I9N1M9 | 244-382 | None |
| A0A7V3ELG3 | 59-186 | None |
| A0A1V5Y956 | 5-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.