DPCstruct | MC17960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 17.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15575 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6HBR1 | 6-197 | CVINYQDRLFDYDIHSIGYAMLSDNLPFIKDVFAKLTYSGFYYEDKTYQKIPVTMEDNVLQGEGAIFTHTMQQFLLGNNALVERNLE… |
| A0A1G4AI75 | 2-183 | LLSDHEELIRWYAGFEWYAGWDGEQPRPKWISQRNYEGLYCGYQTTLALRGEWARVGERSERWLQAPPARLARFIPDMRFFLALAKG… |
| A0A0U2ASZ0 | 109-272 | None |
| A0A5H2XDM4 | 2-137 | None |
| A0A8A7BHU4 | 1-157 | None |
| A0A420XJS2 | 211-380 | None |
| A0A2I1XDF7 | 44-216 | None |
| A0A3M6QM36 | 98-292 | None |
| A0A3M6QXU3 | 20-205 | None |
| A0A2E2G4R4 | 110-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.