DPCstruct | MC17958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 201 ± 44 aa |
| Standard deviation of domain lengths | 43.69 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1KTW3 | 21-219 | TTIGFSFLLGIALFILLPLYATRLFGTMTPVISDNTFIFNLVDGTMRVAVFLVYVFAIGLWKEMRRIYEYHGAEHKVIHAYEKEEAL… |
| A0A3D3I1B0 | 166-320 | LIASGAYMFGLFFVGAHVALFAFLALPTKAQIPWIYDLMSFVFFLLALRLSPLAKIHAAEHMTVHAIEQNEAITPEVVARMPRVHPR… |
| A0A7C1BF15 | 2-164 | None |
| A0A7V4AKM1 | 14-185 | None |
| H0UM77 | 71-302 | None |
| A0A353GEY3 | 250-508 | None |
| A0A645HNB1 | 1-136 | None |
| A0A831WND7 | 42-248 | None |
| A0A7X9J5C2 | 4-126 | None |
| A0A1V3G955 | 43-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.