DPCstruct | MC17957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1GLC5 | 1-140 | DTIIVDTSVMNLPSTSFSILANRLIKEKLGLPCGGAYSNGTHMWKESKEMWGLDGFKAMDAVAQGMSTAIWSDFNFYGPIVTAQRIF… |
| A0A7C4VGH6 | 38-154 | EKPLIDTAVLDAPSIGLAAQATALVKSEFGLPCGGGPVNAVSEWKRVKELGAYAKSVCTANAVAIMQYAGANFILYGPIDKADVVFP… |
| A0A842YFC9 | 62-179 | None |
| A0A1F9DRZ6 | 100-220 | None |
| A0A7J3I3U5 | 1-122 | None |
| A0A2H5VFZ4 | 1-110 | None |
| A0A7C1KSD9 | 65-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.