DPCstruct | MC17956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1182 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 28.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | PF13511- CL0020- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378W3D7 | 74-211 | YTLRYISPFKDTVIRHAQNVNVDPAWVYGLIRQESRFVIGAQSRVGAQGLMQVMPATAREIAGKIGMDAAQLYTADGNIRMGTWYMA… |
| A0A7C1C7R7 | 27-157 | SGSGAVYPDYRRIAEEAARKYGVSPRLAKSVIEVESGWNPGAISRKGAMGLMQLMPETARLYGISDPFDPEENIDAGIRYLKYLIDR… |
| A0A0G0ZY06 | 161-373 | None |
| A0A7W1ER23 | 88-255 | None |
| A0A7W1EKZ4 | 8-197 | None |
| A0A7Y4Y4H4 | 7-208 | None |
| A0A7D5UK01 | 5-143 | None |
| A0A3D5XL25 | 51-196 | None |
| A0A1A9X6Q4 | 347-498 | None |
| A0A355I8H8 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.