DPCstruct | MC17954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 140 |
|---|---|
| Mean domain length (aa) | 257 ± 70 aa |
| Standard deviation of domain lengths | 70.37 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.33 |
| Pfam Score | 96.25 |
| Assigned Pfam label(s) | CL0290- CL0062- CL0063- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6ETE0 | 1-153 | MGGDITLLNERTEGGEPIADVLVRTSKLHGTTIQGDLIPTLIDEIPMIAVMASQAEGTTIIKDAAELKVKETDRIETVTDNLKAMGC… |
| A0A7C0YK81 | 53-320 | RCIHFKSPVASAQVKSAVLLAALYAEGETVVEEPRKSRDHTERMLPAIGADIRVEGLRVIVSGGNDISPFEITVPGDFSSAAFFMVA… |
| A0A7J0G9U8 | 61-244 | None |
| A0A401FNM0 | 5-229 | None |
| A0A0G1RQ58 | 612-926 | None |
| A0A376DLP2 | 1-190 | None |
| A0A6G3VKG8 | 42-236 | None |
| A0A1A9UK93 | 236-549 | None |
| A0A411YK72 | 227-562 | None |
| W2PKS8 | 386-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.