DPCstruct | MC17952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0YGV2 | 3-79 | YCPDVIAELCISDDPSYTTGYIAIKPEGYIRIPNIKSRGCPSGGRAYFLKSRCNVSGVIDYLEKRPVMVTEPSRLNG |
| A0A843EGL3 | 110-181 | ILASKIASCKGIVAELCWSDDPSYVIGYVGTKDNYERIPILKEEGNPIGGRAFFVDTNQLNDNYTLDDLIDY |
| A0A2X4RTW9 | 76-151 | None |
| A0A2D6D3G0 | 2-78 | None |
| A0A822IWV7 | 100-187 | None |
| T0Z5M9 | 4-79 | None |
| A0A1J5NYP4 | 181-272 | None |
| A0A5C2NTB2 | 167-239 | None |
| F5LAY0 | 132-203 | None |
| A0A239W4J2 | 138-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.