DPCstruct | MC17951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397SP52 | 7-136 | NISNDDENFLKDFLKDFYRQIIKIENYKKIENILIDWIKDYFIIKEKNSLMILQLMENHEEKENWFSSLIGFFYEFDIDDNNIMDKN… |
| A0A2I1GAU1 | 6-128 | LKDFLKDFYQKIIDTNNYPFTFENILIEWIKNIDKNTNLILKLMQNHKESKLWFSSIIGFFYQYGIDCIIDKNKALELYLLAINNKE… |
| A0A015JVE4 | 5-149 | None |
| A0A2N0RHU7 | 12-180 | None |
| A0A2N1N6W7 | 1-164 | None |
| A0A2H5SLU4 | 16-151 | None |
| A0A372Q8W8 | 1-123 | None |
| A0A397THN4 | 82-218 | None |
| A0A2H5UDJ9 | 1-160 | None |
| A0A2P4Q6N4 | 3-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.