DPCstruct | MC17950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1NCY7 | 126-199 | WKFKHSKLENHQGYLKSNDIINLSITKEYDNYKISFLRSHDVQFTIENNIFQEVVCHSERLGGNDEWRIELISQ |
| A0A2I1G807 | 3-84 | WKVNHSRLENRQRYLKSNDVINLSVKKFYDNNGEYIEDGCEVFLRSHDIQFTIGNDTFQEVVCHNERLGGNDEWCIELIKQD |
| A0A397STK2 | 2-69 | None |
| A0A015K2Q6 | 1-59 | None |
| U9UQ67 | 49-115 | None |
| U9SWD2 | 89-161 | None |
| A0A2N1NT02 | 134-214 | None |
| A0A372QTZ6 | 70-150 | None |
| A0A372QS80 | 89-170 | None |
| A0A397SS61 | 209-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.