DPCstruct | MC17949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433PCW1 | 1-69 | MMFYEHTNPKEWTSTKVVAHYRDNIQTKELKKILDYVKKDLKKVATTVSRFDGTRRQKAEEIIDTWEVW |
| A0A2I1G6Z9 | 3-75 | IPSTRTLMDFYREAAIEDWTCVNLAEHYHAWSGKKDLKVVMDYMKKDLQKVADYESNFEITRKRKAREILDNW |
| A0A372QK71 | 114-194 | None |
| A0A397J376 | 3-80 | None |
| A0A397J2S8 | 1-80 | None |
| A0A2Z6RTT2 | 1-92 | None |
| A0A433DND6 | 28-93 | None |
| A0A433QJ26 | 1-69 | None |
| A0A2N1MQ33 | 1-73 | None |
| A0A2H5TSZ1 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.