DPCstruct | MC17948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0P7Q6 | 18-143 | LNTSYTSRFSTIDNQRYIPTNPWIPSQKFNKLLNTFETNILNQFICAPCAFCGRLMYPEKCEWLPYNENFPYPLLQAYPEKPFDSLL… |
| A0A2I1G1G2 | 1-133 | MKIRIKIFFRVHLTGDLRLNSKDYILGFRILFLTNGLRIACVYCGKLLYPQKANWISYNPLITYPIQQNIPNISLSFNPNTNRISIP… |
| A0A397J2H0 | 45-153 | None |
| A0A372QDA1 | 49-166 | None |
| A0A372Q1S5 | 1-141 | None |
| A0A2H5R039 | 1-116 | None |
| A0A397GYM0 | 50-161 | None |
| A0A2Z6S590 | 360-471 | None |
| A0A397VAM3 | 292-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.