DPCstruct | MC17946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 49.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QUT8 | 134-269 | SLCRRPKLISSLHALLTKCFIIGHTNRHERQLEKTRMQSIDPTKRLRSGNDIFNLAVIDNIDFKEASFGFGNIYDVTRGTSHATLRM… |
| A0A2I1FS91 | 13-124 | RKPKLLSSLHRLFTIWNVIGHSERHEQNLEKEHINKVIPTQRLYQESNIWNLTIIDNIDFKQKTFSFGNIYDATRDTSHAILRMVFQ… |
| A0A372Q1T2 | 88-239 | None |
| A0A015JWQ2 | 1-99 | None |
| A0A2I1H5R4 | 6-115 | None |
| A0A397J8B2 | 1-115 | None |
| A0A397J0X8 | 101-219 | None |
| A0A397IEM8 | 586-723 | None |
| A0A2H5T282 | 21-133 | None |
| A0A372Q1J1 | 80-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.